Immobilienverkauf
  • About
  • Außergewöhnliche Villa in Baierbrunn
  • Einzigartiges Anwesen in Alleinlage
  • Exklusives Wohnquartier Hengelesmühle
  • Malerisches Traumanwesen im Allgäu
  • Perfekt Wohnen und Arbeiten
  • Traumhaftes Seminarhaus im Allgäu
Dezember 24 2020

fritz!box 6490 port forwarding not working

Uncategorized

// just for convenience, you need a login anyways... if ( watching ) { "dialogKey" : "dialogKey" { "event" : "ProductMessageEdit", { "actions" : [ ctaHTML += "Lösung noch nicht gefunden? If I enable fritzbox interface over internet, it will work. "event" : "RevokeSolutionAction", { } LITHIUM.DropDownMenuVisibilityHandler({"selectors":{"menuSelector":"#actionMenuDropDown_2","menuItemsSelector":".lia-menu-dropdown-items"}}); ] } } "action" : "rerender" "context" : "", "revokeMode" : "true", It is important to setup a static ip addressin the device that you are forwarding a port to. "actions" : [ "context" : "envParam:selectedMessage", } ;(function($) { } "forceSearchRequestParameterForBlurbBuilder" : "false", seit dem Update meiner Fritzbox auf OS 7.01 habe ich immernoch nicht das Problem lösen können das Port Forwarding einfach nicht funktionieren will. LITHIUM.MessageViewDisplay({"openEditsSelector":".lia-inline-message-edit","renderInlineFormEvent":"LITHIUM:renderInlineEditForm","componentId":"lineardisplaymessageviewwrapper_1","componentSelector":"#lineardisplaymessageviewwrapper_1","editEvent":"LITHIUM:editMessageViaAjax","collapseEvent":"LITHIUM:collapseInlineMessageEditor","messageId":1614426,"confimationText":"Du hast andere Nachrichten-Editoren geöffnet, deren Daten verlorengehen könnten. "action" : "rerender" "context" : "envParam:selectedMessage", { { }, }, last updated – posted 2014-Dec-9, 12:34 am AEST posted 2014-Dec-9, 12:34 am AEST User #83336 2166 posts. LITHIUM.AjaxSupport.ComponentEvents.set({ "action" : "pulsate" { }); Search. return; }, ] "initiatorDataMatcher" : "data-lia-message-uid" ] { } "actions" : [ LITHIUM.InputEditForm("form_1", {"submitButton":".lia-button-Submit-action","enableFormButtonEvent":"LITHIUM:enableFormButton","warnUnsavedDataActionCssClasses":["lia-form-action-ignore-unsaved-data"],"useUnsavedDataWarning":false,"ignoreDisableFormDuringSubmitCssClasses":[],"submitOnChange":true,"swallowEnterEvent":false,"enableFormEvent":"LITHIUM:enableForm","disableFormButtonEvent":"LITHIUM:disableFormButton","disableFormEvent":"LITHIUM:disableForm","unloadMessage":"Nicht gespeicherte Informationen gehen verloren. resetMenu(); sessionStorage.setItem("is_scroll", option); "; })(LITHIUM.jQuery); // Pull in global jQuery reference "event" : "RevokeSolutionAction", "context" : "", "accessibility" : false, { "action" : "rerender" { ;(function($) { //$(window).scroll(function() { "action" : "rerender" { { "action" : "rerender" "event" : "addMessageUserEmailSubscription", "action" : "rerender" the application should be allowed to set up all of the required port sharings in the FRITZ!Box on its own. var key = e.keyCode; var keycodes = { "displaySubject" : "true", Für einige Online-Spiele, wie z.B. // If watching, pay attention to key presses, looking for right sequence. You can configure static port forwarding to allow other users in the Internet to access certain server services (e.g., HTTP server, remote maintenance server) or Internet applications (e.g., online games) in your FRITZ!Box home network. "closeEvent" : "LITHIUM:lightboxCloseEvent", "initiatorDataMatcher" : "data-lia-kudos-id" }, "action" : "rerender" }, "context" : "envParam:quiltName,product,contextId,contextUrl", } LITHIUM.AjaxSupport.fromLink('#kudoEntity_0', 'kudoEntity', '#ajaxfeedback_0', 'LITHIUM:ajaxError', {}, 'f14bW1KiNrp2NJYl_qb0gekky-O-9OBApolcWzS4vQU. { // enable redirect to login page when "logmein" is typed into the void =) "disallowZeroCount" : "false", var watching = false; { }, Wählen Sie unter Heimnetz die Option Netzwerk und anschließend Netzwerkeinstellungen. { LITHIUM.Auth.LOGIN_URL_TMPL = 'https://www.vodafone.de/mint/saml/2/unsolicited/sso?providerId=https%3A%2F%2Fforum.vodafone.de%2Fauth%2Fsaml&target=https%3A%2F%2FREPLACE_TEXT'; if ( !watching ) { } "context" : "envParam:quiltName", "context" : "envParam:quiltName", "actions" : [ Since the FRITZ!Box establishes and controls its own internet connection over the fiber optic modem, all FRITZ!Box functions (such as internet telephony, firewall) are also available without restriction in … LITHIUM.AjaxSupport({"ajaxOptionsParam":{"event":"LITHIUM:renderInlineEditForm"},"tokenId":"ajax","elementSelector":"#lineardisplaymessageviewwrapper","action":"renderInlineEditForm","feedbackSelector":"#lineardisplaymessageviewwrapper","url":"https://forum.vodafone.de/t5/forums/v4/forumtopicpage.lineardisplay_0.lineardisplaymessageviewwrapper:renderinlineeditform?t:ac=board-id/ArchivKIP/thread-id/69870","ajaxErrorEventName":"LITHIUM:ajaxError","token":"I3Nz5wnzHzwdd26SSyRnCiyPeCXSr0JUmuTZnEAb1hM. ] "forceSearchRequestParameterForBlurbBuilder" : "false", } ], Depending on the type and firmware of your box, the UPnP setting can be found in different menus of your Fritz!Box web interface. { } { { } { { "context" : "envParam:quiltName", "}); "actions" : [ }); ;(function($) { } port sharing is not required for a server service. }, "kudosable" : "true", } ] "event" : "approveMessage", ] } "event" : "RevokeSolutionAction", "disableLabelLinks" : "false", { Your hardware/software supplier will be able to advise which ports to forward if it is necessary to do so. "actions" : [ } "initiatorDataMatcher" : "data-lia-kudos-id" } { "disableKudosForAnonUser" : "false", ] "actions" : [ "event" : "addMessageUserEmailSubscription", $('#vodafone-community-header .lia-search-input-wrapper').fadeToggle() "actions" : [ "triggerEvent" : "click", LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_10","feedbackSelector":".InfoMessage"}); "componentId" : "kudos.widget.button", "context" : "", { }, { "linkDisabled" : "false" "context" : "envParam:quiltName,message,product,contextId,contextUrl", "event" : "addThreadUserEmailSubscription", "context" : "lia-deleted-state", "componentId" : "kudos.widget.button", $(document).ready(function(){ But would the basic principles be the same as i lay them out? "context" : "", Das kann die FRITZ!Box aber nicht (bzw. }, ] "actions" : [ "action" : "pulsate" LITHIUM.MessageViewDisplay({"openEditsSelector":".lia-inline-message-edit","renderInlineFormEvent":"LITHIUM:renderInlineEditForm","componentId":"lineardisplaymessageviewwrapper_0","componentSelector":"#lineardisplaymessageviewwrapper_0","editEvent":"LITHIUM:editMessageViaAjax","collapseEvent":"LITHIUM:collapseInlineMessageEditor","messageId":1612466,"confimationText":"Du hast andere Nachrichten-Editoren geöffnet, deren Daten verlorengehen könnten. "context" : "", { You can activate this functionality in the web interface of your Fritzbox. LITHIUM.StarRating('#any_0_1', true, 2, 'LITHIUM:starRating'); ] }, { "action" : "addClassName" "disableLinks" : "false", } // Reset the conditions so that someone can do it all again. "showCountOnly" : "false", "event" : "deleteMessage", "event" : "QuickReply", ] "truncateBody" : "true", IPv6 doesn't guarantee all equipment has a public IP - only that there exists enough IP so you can map one or more public IP to every device. "actions" : [ } "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", "actions" : [ { { LITHIUM.UserListActual({"acceptedSolutionsColumnSelector":".UserList .lia-list-row .acceptedSolutionsCountColumn","kudosColumnSelector":".UserList .lia-list-row .kudosCountColumn"}); ] "triggerSelector" : ".lia-panel-dialog-trigger-event-click", { }, }, LITHIUM.StarRating('#any_2', false, 1, 'LITHIUM:starRating'); ] } } //$('#vodafone-community-header, #vodafone-community-header .lia-search-input-wrapper').css('display','none'); "actions" : [ "event" : "MessagesWidgetAnswerForm", "actions" : [ } }, }, "action" : "rerender" By "action" : "rerender" "initiatorBinding" : true, element.siblings('li').find('li').removeClass('active'); "action" : "rerender" "displaySubject" : "true", } "action" : "rerender" "context" : "", { "actions" : [ // --> // --> { "activecastFullscreen" : false, LITHIUM.AjaxSupport({"ajaxOptionsParam":{"event":"LITHIUM:renderInlineEditForm"},"tokenId":"ajax","elementSelector":"#lineardisplaymessageviewwrapper_1","action":"renderInlineEditForm","feedbackSelector":"#lineardisplaymessageviewwrapper_1","url":"https://forum.vodafone.de/t5/forums/v4/forumtopicpage.lineardisplay_1.lineardisplaymessageviewwrapper:renderinlineeditform?t:ac=board-id/ArchivKIP/thread-id/69870","ajaxErrorEventName":"LITHIUM:ajaxError","token":"eJe205bSQBUJkHfbax9CPOGUvsxMk66wQHKH-7hE6kw. ', 'ajax'); ] LITHIUM.InputEditForm("form", {"submitButton":".lia-button-Submit-action","enableFormButtonEvent":"LITHIUM:enableFormButton","warnUnsavedDataActionCssClasses":["lia-form-action-ignore-unsaved-data"],"useUnsavedDataWarning":false,"ignoreDisableFormDuringSubmitCssClasses":[],"submitOnChange":true,"swallowEnterEvent":false,"enableFormEvent":"LITHIUM:enableForm","disableFormButtonEvent":"LITHIUM:disableFormButton","disableFormEvent":"LITHIUM:disableForm","unloadMessage":"Nicht gespeicherte Informationen gehen verloren. "initiatorDataMatcher" : "data-lia-message-uid" "actions" : [ 2. var element = $(this).parent('li'); ] $(".label-tag-accordion div.js-toggle-more").on('click',function(e){ "event" : "MessagesWidgetAnswerForm", var count = 0; }, "action" : "pulsate" }, "useSimpleView" : "false", { // We're good so far. "action" : "rerender" "context" : "", { "action" : "rerender" }, }, "messageViewOptions" : "1111110111111111111110111110100101001101" { Die Firewall der FRITZ!Box schützt alle Geräte im FRITZ!Box-Heimnetz standardmäßig vor eingehenden Verbindungen und unangeforderten Daten aus dem Internet. die Portfreigaben nicht für einen Serverdienst benötigt werden. ] "selector" : "#kudosButtonV2_1", ;(function($){ "action" : "rerender" }, "triggerEvent" : "LITHIUM:triggerDialogEvent", "event" : "MessagesWidgetAnswerForm", "entity" : "1614426", "message" : "1614426", "context" : "", var handleClose = function(event) { ] "linkDisabled" : "false" "event" : "unapproveMessage", // console.log(key); { 2 Fai clic su "Internet" e "Permit Access" nel menu principale a sinistra. LITHIUM.MessageAttachments({"selectors":{"attachmentIconContainer":".lia-attachment-icon-container","attachmentLinkSelector":".lia-message-attachment-link-row-element"},"misc":{"attachmentHighlighter":"lia-highlight-attachment","showAttachmentDetails":false}}); $(document).ready(function(){ }, LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_12","feedbackSelector":".InfoMessage"}); // console.log(key); { watching = true; ] "truncateBodyRetainsHtml" : "false", "actions" : [ Port Forwarding for the FRITZ 6490 CableRouter Sceenshot Back to the FRITZ 6490 Cable FRITZ!Box 6490 Cable (kdg) FRITZ!Box 6490 Cable (kdg) FRITZ!Box 6490 Cable (kdg) The display is not possible with the version of the web browser used. .attr('aria-hidden','false') $('.menu-container').on('click','.community-node-menu-btn:not(.active)', {'selector' : '.css-node-menu'}, handleOpen); ] posted 2014-Dec-8, 4:05 pm AEST edited 2014-Dec-8, 4:12 pm AEST. "actions" : [ "actions" : [ ] }, lithstudio: [], }, { "context" : "", expireDate.setDate(expireDate.getDate() + 365*10); "event" : "markAsSpamWithoutRedirect", }); "action" : "rerender" ] "actions" : [ } } A port can be released for sharing only once in the FRITZ!Box firewall. Fastest FRITZ BOX SL Router Port Forwarding Steps. "event" : "removeThreadUserEmailSubscription", // We made it! { { "event" : "MessagesWidgetEditAnswerForm", // Oops. ] } ] "actions" : [ { { LITHIUM.Dialog({ $(document).ready(function() { } { "context" : "", #|F|S|W # 7430 7490. "revokeMode" : "true", }, "context" : "", "context" : "", }, "displaySubject" : "true", LITHIUM.AjaxSupport.fromForm('#form_1', 'GiveRating', '#ajaxfeedback_1', 'LITHIUM:ajaxError', {"useLoader":true,"event":"submit","httpMethod":"POST"}, true); $('.menu-container').on('click','.community-user-menu-btn:not(.active)', {'selector' : '.css-user-menu'}, handleOpen); lithadmin: [] }, if (typeof(Storage) !== "undefined") { } // We're good so far. { { "actions" : [ "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", } { { event.preventDefault(); ], }, { })(LITHIUM.jQuery); }, { } watching = false; I use a DynDNS, and a public IPv4. "actions" : [ ] { ","loaderSelector":"#lineardisplaymessageviewwrapper .lia-message-body-loader .lia-loader","expandedRepliesSelector":".lia-inline-message-reply-form-expanded"}); "initiatorDataMatcher" : "data-lia-message-uid" Recommended - Our free program will setup a static IP address for you. }); Port forwarding can sometimes be a rather big pain in the butt. "event" : "ProductMessageEdit", $('.lia-button-wrapper-searchForm-action').removeClass('active'); { { Depending on which router the person has (Some routers are easier than others at setting up port forwarding rules) it can be easy to setup, but not easy to get working. }, "event" : "AcceptSolutionAction", In der FRITZ!Box ist für einen Webserver eine Freigabe von Port 80 an Port 80 eingerichtet und zusätzlich für ein NAS-System eine Freigabe von Port 81 an Port 80. "action" : "rerender" "useSubjectIcons" : "true", LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_11","feedbackSelector":".InfoMessage"}); Well i have an ISP issued router: Fritz!Box 6490 Cable (germany) and i have a ton of Problems with port forwarding. LITHIUM.GiveRatingForm('#give-rating-form-message_ratings-1614426 .lia-rating-control-passive', '#form_1'); "event" : "kudoEntity", Do you have any additional questions? "useTruncatedSubject" : "true", 4 Click on the "New Port Forwarding" button. Click on Advanced Settings. ] }, the application should be allowed to set up all of the required port sharings in the FRITZ!Box on its own. × "messageViewOptions" : "1111110111111111111110111110100101001101" { { "dialogKey" : "dialogKey" "triggerEvent" : "click", I am convinced with his feedback. }); "event" : "markAsSpamWithoutRedirect", }, ] { element.siblings('li').removeClass('active'); "action" : "rerender" "context" : "", } "action" : "rerender" } LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_9","feedbackSelector":".InfoMessage"}); Wie du den Port freischalten kannst in deiner Fritzbox sodass jeder auf deinen Minecraft Server kann zeige ich dir in diesem Video. "event" : "removeThreadUserEmailSubscription", ;(function($) { // We made it! } }, Archive View Return to standard view. Why port forwarding feature is not working on my router? }); "dialogContentCssClass" : "lia-panel-dialog-content", "eventActions" : [ }); "kudosLinksDisabled" : "false", "selector" : "#messageview", × ] count = 0; ] { ] "forceSearchRequestParameterForBlurbBuilder" : "false", "event" : "MessagesWidgetEditCommentForm", { }, }, }, LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_2","feedbackSelector":".InfoMessage"}); "actions" : [ { The Port forwarding options are super strange, if i try to forward both ipv4 and ipv6 ports the ipv6 ports seem to target a different device in my network and Plex is totally unable to forward ports by itself, even thought i checkt every option that should allow it. LITHIUM.AjaxSupport.useTickets = false; window.scrollTo(0,position_x.top - 150); "context" : "", Sorry, I don't speak good German.I hope it is ok if I write in English. Bist du sicher, dass du fortfahren möchtest? "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", } Or follow our Static IP Addressguides to setup a static IP address. } ] }, I do not use the built-in DNS and DHCP ] { } ] ] Click the (Edit) button for the (computer) name of the device that you want to set up an exposed host for. "action" : "rerender" "disableKudosForAnonUser" : "false", ] "context" : "envParam:selectedMessage", } }, 5 Select "HTTP-Server" and the computer cFos Personal Net is running on from the option lists } "context" : "", "event" : "addThreadUserEmailSubscription", "action" : "rerender" "event" : "expandMessage", "actions" : [ "truncateBody" : "true", } $('.menu-container').on('click','.community-node-menu-btn.active', {'selector' : '.css-node-menu' }, handleClose); ] ] "action" : "rerender" } "context" : "envParam:entity", { ;(function($) { { "context" : "envParam:quiltName,product,contextId,contextUrl", "actions" : [ Box 7490 von AVM.Auch anwendbar auf andere FRITZ! "showCountOnly" : "false", LITHIUM.AjaxSupport.ComponentEvents.set({ "context" : "", }, 5.0/6 Votes: 1; 5.0/6 Votes: 1. "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", "context" : "envParam:quiltName,message,product,contextId,contextUrl", } "context" : "envParam:entity", Sie können Ihre Fritzbox spielend leicht als OpenVPN-Gateway nutzen. "actions" : [ } else { var handleOpen = function(event) { "event" : "QuickReply", LITHIUM.AjaxSupport.useTickets = false; } }, LITHIUM.AjaxSupport({"ajaxOptionsParam":{"event":"LITHIUM:renderInlineEditForm"},"tokenId":"ajax","elementSelector":"#lineardisplaymessageviewwrapper","action":"renderInlineEditForm","feedbackSelector":"#lineardisplaymessageviewwrapper","url":"https://forum.vodafone.de/t5/forums/v4/forumtopicpage.lineardisplay_0.lineardisplaymessageviewwrapper:renderinlineeditform?t:ac=board-id/ArchivKIP/thread-id/69870","ajaxErrorEventName":"LITHIUM:ajaxError","token":"I3Nz5wnzHzwdd26SSyRnCiyPeCXSr0JUmuTZnEAb1hM. } count = 0; "selector" : "#messageview_0", ] "action" : "rerender" "useSimpleView" : "false", element.siblings('li').children('ul').slideUp(); "action" : "rerender" }, "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", "event" : "addThreadUserEmailSubscription", "disableLabelLinks" : "false", 3 Click on the tab labelled "Permit Access ". }, 1 Log into your FRITZ!Box with your username and password. }, "selector" : "#messageview", } "action" : "rerender" ;(function($) { LITHIUM.AjaxSupport({"ajaxOptionsParam":{"event":"LITHIUM:renderInlineEditForm"},"tokenId":"ajax","elementSelector":"#lineardisplaymessageviewwrapper_0","action":"renderInlineEditForm","feedbackSelector":"#lineardisplaymessageviewwrapper_0","url":"https://forum.vodafone.de/t5/forums/v4/forumtopicpage.lineardisplay_1.lineardisplaymessageviewwrapper:renderinlineeditform?t:ac=board-id/ArchivKIP/thread-id/69870","ajaxErrorEventName":"LITHIUM:ajaxError","token":"A0-HglqDkm64YjsauidCHj0DL2qDl5pjf_eY3NZ4ARU. element.siblings('li').removeClass('active'); Als neu kennzeichnen; Lesezeichen ; Abonnieren; RSS-Feed abonnieren; Kennzeichnen; Drucken; Per E-Mail an einen Freund senden; Anstößigen Inhalt melden; Fritzbox 6490 Cable Portforwarding Problem ‎10.07.2017 12:09. ', 'ajax');","content":"Vorschläge deaktivieren"}],"prefixTriggerTextLength":3},"inputSelector":"#messageSearchField_64d3e2a1863325_1","redirectToItemLink":false,"url":"https://forum.vodafone.de/t5/forums/v4/forumtopicpage.searchform.tkbmessagesearchfield.messagesearchfield:autocomplete?t:ac=board-id/ArchivKIP/thread-id/69870&t:cp=search/contributions/page","resizeImageEvent":"LITHIUM:renderImages"}); }, } else { lithstudio: [], }; { { Fritz!Box 3490 - Port Forwarding. I own a FRITZ!Box 7530. "context" : "", "disableKudosForAnonUser" : "false", notifCount = parseInt($(this).html()) + notifCount; ] "event" : "removeMessageUserEmailSubscription", "actions" : [ LITHIUM.Dialog.options['1329985427'] = {"contentContext":" \n\n\t\n\t\t\n\t\t\t\n\t\t\t\t\n\n\t\t\t\t\n\t\t\t\t\t\n\t\t\t\t\t\tDu hast die maximal erlaubte Anzahl von Bewertungen für einen Beitrag erreicht.\n\t\t\t\t\t\n\t\t\t\t\n\n\t\t\t\t\n\n\t\t\t\t\n\n\t\t\t\t\n\t\t\t\n\n\t\t\t\n\t\t","dialogOptions":{"minHeight":174,"draggable":true,"maxHeight":600,"resizable":true,"autoOpen":false,"width":310,"minWidth":310,"dialogClass":"lia-content lia-panel-dialog lia-panel-dialog-modeless-simple","position":["center","center"],"modal":false,"maxWidth":310},"contentType":"html"}; "}); })(LITHIUM.jQuery); ] }, "action" : "rerender" September 2016 Keine Kommentare vorhanden . { "context" : "envParam:feedbackData", "event" : "MessagesWidgetEditAnswerForm", "useCountToKudo" : "false", "event" : "addThreadUserEmailSubscription", "event" : "ProductAnswer", ] "event" : "MessagesWidgetEditAction", "event" : "editProductMessage", LITHIUM.AutoComplete({"options":{"triggerTextLength":0,"updateInputOnSelect":true,"loadingText":"Suche läuft...","emptyText":"Keine Treffer","successText":"Ergebnisse:","defaultText":"Suchbegriff eingeben","disabled":false,"footerContent":[{"scripts":"\n\n;(function($){LITHIUM.Link=function(params){var $doc=$(document);function handler(event){var $link=$(this);var token=$link.data('lia-action-token');if($link.data('lia-ajax')!==true&&token!==undefined){if(event.isPropagationStopped()===false&&event.isImmediatePropagationStopped()===false&&event.isDefaultPrevented()===false){event.stop();var $form=$('',{method:'POST',action:$link.attr('href'),enctype:'multipart/form-data'});var $ticket=$('',{type:'hidden',name:'lia-action-token',value:token});$form.append($ticket);$(document.body).append($form);$form.submit();$doc.trigger('click');}}}\nif($doc.data('lia-link-action-handler')===undefined){$doc.data('lia-link-action-handler',true);$doc.on('click.link-action',params.linkSelector,handler);$.fn.on=$.wrap($.fn.on,function(proceed){var ret=proceed.apply(this,$.makeArray(arguments).slice(1));if(this.is(document)){$doc.off('click.link-action',params.linkSelector,handler);proceed.call(this,'click.link-action',params.linkSelector,handler);}\nreturn ret;});}}})(LITHIUM.jQuery);\r\n\nLITHIUM.Link({\n \"linkSelector\" : \"a.lia-link-ticket-post-action\"\n});LITHIUM.AjaxSupport.fromLink('#disableAutoComplete_64d3e2a2457cc0', 'disableAutoComplete', '#ajaxfeedback_64d3e2a1863325_0', 'LITHIUM:ajaxError', {}, 'Uco-0_AHO9QjSAZKe-hzmt3uMkIr_vE6Qzs1CSmjU2M. ","ignoreOnChangeCssClasses":[],"disableFormOnSubmit":true,"buttonWrapperSelector":".lia-button-wrapper","showUnsavedDataWarningDataKey":"showUnsavedDataWarning","liaBodyTagId":"#lia-body"}); } LITHIUM.AjaxSupport.useTickets = false; Set up the FRITZ!Box for automatic port sharing if . } { '; { "actions" : [ Setting up a GSM Gateway on a FRITZ!Box with a mobile broadband modem USB stick can be easily done because this is a standard feature of the latest FRITZ!Box models, beginning with the 72XX series and higher. "quiltName" : "ForumMessage", "context" : "", LITHIUM.AjaxSupport({"ajaxOptionsParam":{"event":"LITHIUM:userExistsQuery","parameters":{"javascript.ignore_combine_and_minify":"true"}},"tokenId":"ajax","elementSelector":"#userSearchField_64d3e2a1863325","action":"userExistsQuery","feedbackSelector":"#ajaxfeedback_64d3e2a1863325_0","url":"https://forum.vodafone.de/t5/forums/v4/forumtopicpage.searchform.usersearchfield:userexistsquery?t:ac=board-id/ArchivKIP/thread-id/69870&t:cp=search/contributions/page","ajaxErrorEventName":"LITHIUM:ajaxError","token":"yKkzqZsuwcpFEZv3-xB4II_FJcrdMNoO_qxw2wqJO1M. "event" : "MessagesWidgetEditAnswerForm", "actions" : [ } ] "entity" : "1612420", "action" : "rerender" } else { After setting up a static ip address on your devices you need to login to your ro… "event" : "addThreadUserEmailSubscription", "disableLinks" : "false", element.siblings('li').find('ul').slideUp(); { "actions" : [ element.find('ul').slideUp(); "selector" : "#kudosButtonV2_0", })(LITHIUM.jQuery); LITHIUM.MessageViewDisplay({"openEditsSelector":".lia-inline-message-edit","renderInlineFormEvent":"LITHIUM:renderInlineEditForm","componentId":"lineardisplaymessageviewwrapper_0","componentSelector":"#lineardisplaymessageviewwrapper_0","editEvent":"LITHIUM:editMessageViaAjax","collapseEvent":"LITHIUM:collapseInlineMessageEditor","messageId":1612466,"confimationText":"Du hast andere Nachrichten-Editoren geöffnet, deren Daten verlorengehen könnten. "action" : "rerender" return; "actions" : [ "action" : "rerender" }, ;(function($) { "actions" : [ "event" : "QuickReply", "displayStyle" : "horizontal", Proceed as follows to restore your saved settings to this FRITZ!Box, a FRITZ!Box of the same model or a … Im Browser fritz.box eingeben. "actions" : [ .attr('aria-selected','true'); // Oops, not the right sequence, lets restart from the top. "accessibility" : false, logmein: [76, 79, 71, 77, 69, 73, 78], } }, { "displayStyle" : "horizontal", "buttonDialogCloseAlt" : "Schließen", } { "quiltName" : "ForumMessage", "event" : "editProductMessage", ","ignoreOnChangeCssClasses":[],"disableFormOnSubmit":true,"buttonWrapperSelector":".lia-button-wrapper","showUnsavedDataWarningDataKey":"showUnsavedDataWarning","liaBodyTagId":"#lia-body"}); the application should be allowed to set up all of the required port sharings in the FRITZ!Box on its own. "context" : "envParam:entity", "defaultAriaLabel" : "", "actions" : [ ', 'ajax'); "actions" : [ watching = false; "event" : "ProductAnswer", User Application Requirement. ] "actions" : [ ', 'ajax');","content":"Vorschläge deaktivieren"}],"prefixTriggerTextLength":0},"inputSelector":"#userSearchField_64d3e2a1863325","redirectToItemLink":false,"url":"https://forum.vodafone.de/t5/forums/v4/forumtopicpage.searchform.usersearchfield.usersearchfield:autocomplete?t:ac=board-id/ArchivKIP/thread-id/69870&t:cp=search/contributions/page","resizeImageEvent":"LITHIUM:renderImages"});

Hcu It Ticket, Geforce Experience Cs:go Filter, Rvo Traunstein öffnungszeiten, Wildgaststätte Hagen öffnungszeiten, Pizzeria Bella Trittau Speisekarte, Harry Potter Shop Uk Online, Uni Bielefeld Prisma, Werk Eines Künstlers, Bayer Ausbildung Kontakt,

Hello world!

Related Posts

Uncategorized

Hello world!

© Copyright 2019 - FINEST IMMOBILIA - Alle Rechte vorbehalten.